Lijst van ingrediënten - World

761 ingrediënten:

IngrediëntProducten*
Zout 43
Suiker 42
Groente 28
Plantaardige vetten en olie 28
Water 28
Zuivel 27
Olie 27
Aroma 25
Granen 21
Wortelgewas 19
Melk 19
Vruchten 19
Meel 18
Plantaardige olie 18
Tarwe 17
Natuurlijke smaakstoffen 17
Granenmeel 16
Specerijen 16
Glucose 15
Tarwemeel 14
Paprika 14
Kruiden 13
Zetmeel 12
E330 12
Zeezout 11
Palm olie en vet 10
Ei 10
Tomaat 9
Zonnebloemolie 9
Room 9
Emulgator 9
Conserveermiddel 9
Knoflook 9
Antioxydant 9
Kleuren 8
Cacao 8
Melkpoeder 8
Vruchtensap 8
Koolzaadolie 8
Stabilisator 8
Voedingszuur 8
E322 8
Ui 8
Rietsuiker 8
Gist 8
Dextrose 8
Sojalecithine 7
E500 7
E450 6
Magere melkpoeder 6
Cacaoboter 6
Maïszetmeel 6
Palmolie 6
Wortel 6
Invertsuiker 6
Plant 6
Microbiële cultuur 5
Ferment 5
Melkfermenten 5
Glucosestroop 5
Mout 5
Kaas 5
Rijsmiddel 5
Peterselie 5
Honing 5
Dier 5
E300 5
Azijn 5
Varken 5
Gemodificeerd zetmeel 5
E440a 5
Palmvet 4
Cacaomassa 4
Gerstemout 4
Rapeseed oil 4
Appel 4
Citrusvrucht 4
Spinazie 4
Soja 4
Boterconcentraat 4
Boter 4
Verdikkingsmiddel 4
Fructose 4
Varkensvlees 4
Rijst 4
Zaad 4
Vis 4
Zalm 4
Vlees 4
Vanille 4
Volle melkpoeder 4
E950 3
Wei 3
Abrikoos 3
Kurkuma 3
Eigeel 3
Magere melk 3
Glucose-fructosestroop 3
E503 3
Volle melk 3
Rode vruchten 3
E451 3
Sodawater 3
Basilicum 3
E375 3
E407 3
Ei-eiwit 3
E301 3
Deeg 3
Sacharose 3
Aardbei 3
Eiwitten 3
Zout uit Guérande 3
Gerstemoutextract 3
E1510 3
Dierlijk proteine 3
Biet 3
Melkeiwit 3
E410 3
E471 3
Kruiden en specerijen 3
Tomatenpurée 3
Olijfolie 3
Zoetstof 3
E250 3
Gemodificeerd maïszetmeel 3
E412 2
Stremmingsenzymen 2
Stremsel 2
Vanilline 2
Gistpoeder 2
Hele eieren 2
E202 2
Zuurteregelaar 2
Koemelk 2
Geleermiddel 2
Gecondenseerde melk 2
Cacaopoeder 2
Citroen 2
Spirulina concentrate 2
Vruchtsap van concentraat 2
Paprika 2
Kaneel 2
E150a 2
Zwarte peper 2
Uienpoeder 2
Mosterdzaad 2
Druif 2
Plantaardige vetten 2
Gistextract 2
Noot 2
Vitaminen 2
Gesteriliseerde melk 2
Palm 2
Vanille-extract 2
Appelsap 2
Nootmuskaat 2
Spirulina 2
Citroensap 2
Kokosnoot 2
Kokosolie 2
fi:makeutusaineet 2*
Rookaroma 2
Sinaasappel 2
Hazelnoot 2
Pinda 2
Appeldiksap 2
Olijfolie van de eerste persing 2
Gedroogde glucosestroop 2
Alcoholazijn 2
Sesam 2
Mineralen 2
E150d 2
Ongeraffineerde rietsuiker 2
Schelpdier 2
Atlantische zalm 2
Whole fresh eggs 2
Puree 2
fr:les-informations-en-gras-sont-destinees-aux-personnes-allergiques-et-intolerantes 2*
Gluten 2
Mosterd 2
Aardappel 2
Courgette 2
Gepasteuriseerde melk 2
E955 2
Sulfiet 2
Rode paprika 2
Aardappelzetmeel 2
Pepers 2
E415 2
E450i 2
Witte peper 2
E965ii 1
fi:yrttiuute 1*
fi:aromit 1*
curcuma 1*
bruine-en-gele-mosterd-zaden-fair-trade-organic 1*
natuurazijn-fair-trade-organic 1*
klasse-ii 1*
Tenroy 1
Royal Gala appel 1
fr:jus-de-raisin-a-partir-de-concentre-de-raisin 1*
fr:jus-d-ananas-a-partir-d-ananas-concentre 1*
fr:extracto-de-pimenton 1*
fr:de-leche 1*
fr:queso-en-polvo 1*
fr:sustancias-aromatizantes 1*
fr:lactosa 1*
fr:copos-de-patata 1*
fr:aroma-a-queso 1*
fr:fecula-de-patata 1*
fr:caco-de-pate 1*
Tarwezetmeel 1
Tarwegluten 1
E141 1
E100 1
fr:suero-de-leche-en-polvo 1*
sv:vegetabiliskt-fett 1*
Magere cacaopoeder 1
ro:ulei-rafinat-de-floarea-soarelui 1*
Microbieel stremsel 1
E104 1
fr:teintes 1*
Natuurlijk citroenaroma 1
en:fructose-glucose-syrup 1*
E621 1
Kruidnagel 1
fr:moutarde-legumineuses 1*
Kerriepoeder 1
fr:epices-pour-poulet-sel 1*
en:original-beans-chocolate 1*
Gerstemeel 1
1*
Barley malt flour 1
Rijstebloem 1
de:Weizenvollkornflocken 1
de:Reisextrudat 1
it:conservare-in-luogo-fresco-e-asciutto-e-al-riparo-da-fonti-di-luce-e-di-calore 1*
Haver 1
Volkoren havermout 1
fr:kaliumjodat 1*
fr:speisesalz 1*
it:mosto-di-uva-cotto-fair-trade-organic 1*
fr:gerostetes-gerstenmalzmehl 1*
fr:natriumacetate 1*
fi:sakeuttamisaine-arabikumi 1*
fr:saureregulator 1*
fr:hefe 1*
fr:haferflocken 1*
it:certificato-da-organismo-di-controllo-autorizzato-dal-mipaaf 1*
fr:roggenmehl 1*
Citroenmelisse 1
en:double-cream 1*
fr:weizenmehl 1*
E967 1
Wijn 1
fi:eukalyptusoljy 1*
fi:variaine-e150c 1*
Menthol 1
Peperextract 1
fr:weizenvollkornmehl 1*
E160c 1
Brandewijnazijn 1
de:pastinaken 1*
de:gerinnungsmittel 1*
extra-vierge-olijfolie-fair-trade-organic 1*
de:gemüsebrühe 1*
Coating 1
de:füllung 1*
Gries 1
Harde tarwe griesmeel 1
Weipoeder 1
E524 1
it:aceto-di-vino-fair-trade-organic 1*
Fenugreek 1
de:brezellauge 1*
Lactose 1
fr:pointe-de-jambon-traite-en-salaison 1*
Volle gepasteuriseerde melk 1
fr:grains-de-vanille 1*
E965 1
Suikerstroop 1
fr:Concentré de carotte 1
fr:pib-pili 1*
Durum tarwe 1
fr:calibre-40 1*
Curry 1
fr:melange-de-minis-poivrons 1*
fr:oug-de-la-briqe 1*
Natuurlijk muntaroma 1
fr:arome-naturel-de-concombre 1*
fr:jus-et-puree-de-pomme83-7-jus-de-concombre-10-puree-de-panais-4-jus-de-citron 1*
fr:carbonate-acide-de-sodium-carbonate-d-ammonium 1*
en:cacao-butter-from-cacao-beans 1*
fr:perles-de-chocolat 1*
fr:farine-de-froment-sucre-de-canne 1*
fr:Huile de tournesol oléique désodorisée 1
fr:Sirop de blé 1
Tarwemeel T65 1
es:grasa-minima-de-leche 1*
es:yema-de-huevo-pasteurizada 1*
fr:paprika-oignons 1*
fr:agriculture-ue 1*
Smaakversterker 1
fr:fruits-a-coques-produit-certifie-par-ecocert-fr-bio-01 1*
Mangopuree 1
Pruim 1
fr:inosinato-y-guanilato-disodicos 1*
fr:fourrage-creme-de-pruneaux 1*
fr:semoule-de-riz 1
Rauwe melk 1
fr:ii 1*
fr:calibre-50 1*
fr:epais 1*
fr:caramel-au-beurre-sale-au-sel-de-guerande 1*
fr:lait-reconstitue-a-2-1-de-matiere-grasse 1*
en:caramel-ordinaire 1*
en:arome-naturel-de-vanille 1*
en:extrait-naturel-de-vanille 1*
en:sucre-ethylvanilline 1*
fr:i 1*
fr:voir-la-date-sur-le-cote-ne-jamais-recongeler-un-produit-decongele 1*
E326 1
fr:dans-un-congelateur-a 1*
fr:l-usage-du-four-a-our-is-ondes-est-deconseille-rvation 1*
Rabarber 1
fr:au-four-traditionnel 1*
fr:doitrine-de-porc 1*
fr:contient-de-la-mouta 1*
fr:pectines-s-lactiques 1*
fr:crema-ala-pe-incluida-ins-nectinas-fermentos-lacticos-oueso-de-cabre 1*
fr:sal-crema-agria-luz 1*
fr:entes 1*
fr:queso 1*
fr:cloruro-potasico 1*
Amandel 1
fr:almidones-y-feculas 1*
fr:espesantes 1*
en:cacao-kernel-from-cacao-beans 1*
fr:kurbiskerne 1*
fr:pizza-con-crema 1*
fr:harina-de-trigo-agua-aceite-de-girasol-la-leche 1*
fr:registro-de-queso-de-cabra 1*
fr:18-c 1*
fr:blumenkerne 1*
fr:ormations-en-gras-sont-destinees-aux-personnes-ntes-et-allergiques 1*
Venkel 1
fr:possibles-de-poisson 1*
fr:non-ue 1*
fr:masa 1*
fr:ques 1*
fr:epices-et-plantes-extrose 1*
fr:nitrite-de-sodium-fromage-rape-9-1-imaasdam-fecule-de-pomme-de-terrel 1*
fr:fumes-cuits 1*
fr:sel-creme-epaisse-legere 1*
Vezel 1
fr:eau-huile-de-tournesol-oulangere 1*
fr:ents 1*
fr:cuite-au-feu-de-bois 1*
Maasdammer 1
fr:s 1*
de:himbeersaft-aus-himbeersaftkonzentrat 1*
Geitenkaas 1
fr:sirop-d-amidon-de-riz 1*
fr:zz-a-a-pizza-garnie-de-creme 1*
fr:levadura 1*
Gedroogde pruimen 1
fr:peut-contenir-des-noyaux-et-morceaux-de-noyaux-et-des-traces-de-fruis-a-coque 1*
Vruchtenpectine 1
fr:55 1*
fr:cheetos-pandilla-producto-de-aperitivo-frito-con-sabora-queso-ingredientes 1*
Gecondenseerde magere melk 1
fr:potenciadores-del-sabor 1*
fr:les-informations-en-gras-sont-destinees-aux-personnes-intolerantes-et-allergiques 1*
Sojaboon 1
fr:sirop-d-agave-arome-naturel-de-citron 1*
Tofu 1
fr:surgelee 1*
fr:ingredients-saumon-atlantique 1*
Caramel syrup 1
Pijnboompitten 1
Gekaramelliseerde suiker 1
de:unter-schutzatmasphäre-verpackt 1*
E160 1
Gecondenseerde gesuikerde melk 1
de:helyen-tarolande-hraniti-na-hladm-in-suhem 1*
Broccoli 1
fr:de-preparation 1*
fr:t-servings-per-container-8-milk-chocolate 1*
sv:aromer 1*
Koriander 1
fr:concentre-de-carthame-des-teinturiers 1*
Cafeïne 1
de:speisesalaz 1*
fr:aleur-nutritionnelle-moyenne 1*
fr:ingredients-a-proprietes-colorantes 1*
de:a-termék-nyomokban-diófeleket-tartalmazhat-slo-arasidi 1*
fr:aroma-de-humo 1*
fr:Levain de blé 1
de:knoblauchgranulat 1*
Zuurdesem 1
fr:ultracongelado 1*
fr:or-soybean-daily-value-hydrogenated-soybean-oil 1*
en:cocoa-mass 1*
de:sós-földimogyoró 1*
Rode biet 1
de:praženi-in-slani 1*
fi:pintakasittelyaine-mehilaisvaha 1*
Ananas 1
IJzer 1
en:concentrated-butter 1*
Ciderazijn 1
sv:vasslepulver 1
de:d-59939-olsberg 1*
fr:pain-special-pour-hamburger-saupoudre-de-graines-speciaal-brood-voor-hamburgers-met-graandecoratie-inaredients 1*
Sojabloem 1
de:enthält-spuren-von-schalenfrüchten 1*
fr:total-fat-6g-saturated-fat-3-5g-trans-fat-0g-cholesterol-10mg-sodium-85mg-total-carbohydrate-22g-dietary-fiber-og-sugars-12g-protein-1g-6-syrup-solids 1*
Sinaasappelsap 1
Bananenpuree 1
Ananassap 1
en:cacao-minimum 1*
Smoked salmon 1
Veenbessen 1
de:sestavine 1*
fr:deshydrate 1*
fr:lait-frais-du-haut-doubs 1*
fr:extraits-de-romarin-bio 1*
Antiklontermiddel 1
fr:delpierre-rue-st-exupery-44860-st-aignan-de-grand-lieu 1*
en:palm-rspo 1*
Gekookte pasta 1
Raapolie 1
fr:vitamin-c-calcium-percent-daily-values-are-based-on-a-2-000-calorie-diet 1*
Kippenei-eiwitpoeder 1
Vanilla beans exhausted 1
fr:harinas-de-arroz-y-maiz 1*
fr:extrait-standardise 1*
en:fruit-and-vegetable-extract-blend 1*
fr:tarwegluten 1*
fr:a-nmer-de-preference-avant-le 1*
fr:iron-satisfaction-guaranteed 1*
Vitamine B12 1
Gekarameliseerde suiker 1
de:száraz 1*
Natural cinammon flavouring 1
Gemalen kokos 1
en:for-color 1*
fr:graines-de-pauot-maanznden 1*
fr:total-fat-sat-fat-cholesterol-less-than-300mg-sodium-total-carbohydrate-dietary-fiber-300mg-less-than-2-400mg-2-400mg-375g-bo0-6gz-thank-you 1*
Acerolasap 1
fr:glutamato-monosodico 1*
fr:cf-of-tartar 1*
Kers 1
sv:vegetabiliskt-emulgeringsmedel 1*
fr:roggennatursauerteig 1*
fr:variete-orange-rubis 1*
de:trocken-lagemr-warme-schützen 1*
Tapioca zetmeel 1
Zure room 1
fr:ee-de-kiwi 1*
en:concentrated-strawberry-juice 1*
fr:sonnen 1*
fr:please-call-1-888-737-7374-2-500-calories 1*
E414 1
Gember 1
fr:ba-soda 1*
Geraspte emmentaler 1
fr:proteines-de-pois-hydroly-sees 1*
en:belgian-chocolate-chips 1*
es:jugo-de-limon-natural-y-acido-citrico 1*
Chocola 1
en:non-gmo-soy-lecithin 1*
E500ii 1
fr:prechauffez-a-210-c 1*
fr:e407-emulsifiant 1*
fr:fabrique-par 1*
fr:contains-less-of 1*
Aardappelpoeder 1
fr:zout 1*
E161b 1
Kokosmelk 1
de:soninicna-olje 1*
Zonnebloem 1
de:natürliches-vanille-aroma 1*
fr:reduced-iron 1*
en:concentrated-apple-puree 1*
Rijst uit Italië 1
de:weißweinessig 1
Bladspinazie 1
fi:variaine-kurkuma 1*
fr:your-daily-values-may-be-higher-or-lower-depending-on-your-calorie-needs 1*
Bouillon 1
fr:foie-gras-de-canard-entier-d-armorique 1*
de:izdelek-lahko-vsebuje-ledove-oresckov 1*
en:colorant 1*
Dubbel geconcentreerde tomatenpuree 1
fr:e-amount-per-serving-calories-140-calories-from-fat-50-sugar 1*
fr:poivre-pili-pili 1*
de:napraforgó-olai-etkezési-so 1*
en:chickpeatos-blend 1*
fr:va-extract 1*
en:cornstarch 1*
Kikkererwt 1
honing-fair-trade-organic 1*
fr:peut-contenir-des-traces-de 1*
Paprikapoeder 1
en:green-peas 1*
fr:fleurs-de-surface 1*
Tarwezemelen 1
fr:graines-de-boekueit 1*
Bosvruchten 1
fr:ammonium-bicarbona-contains 1*
de:készült-az-eu-ban 1*
fr:aceite-de-maiz 1*
fr:jus-de-citron-fabrique-dans-un-atelier-manipulant-du-lait 1*
de:nettogewicht 1*
fr:noisette-nougatine 1*
fr:erythorbate-de-s0dium 1*
fr:m-dextrose 1*
fr:colorantes 1*
E511 1
es:jasminum-officinale 1*
es:leche-desnatada-rehidratada 1*
Erwt 1
fr:viande-de-porc-issue-de-porcs-label-rouge 1*
Sweet whey 1
de:weizenmehl-type-550 1*
fr:variete-magic-cot 1*
en:natural-key-lime-flavor 1*
Parmezaanse kaas 1
it:senza-glutine 1*
de:jedilina-sol 1*
fi:happamuudensaatoaine-sitruunahallo 1*
de:hu-pörkölt 1*
en:riboflavin 1*
fr:ingredie-ten 1*
Appelmoes 1
en:blend-of-lemon-flavor-and-lemon-concentrate 1*
fr:ateur 1*
fr:inc 1*
de:maltosesirup 1*
fr:foli-facts-made-from 1*
Weekdieren 1
de:vedogázas-csomagolásban 1*
Vitamine C 1
fr:Farine de pomme de terre 1
fr:nitrite-de-sodium-antioxydant 1*
Pindaolie 1
Tarwevlokken 1
E316 1
Tarwemout 1
fr:mola-palm-and 1*
fr:semoule-de-mais-43-5-farine-de-ble 1*
Fructose syrup 1
fr:retirez-le-enfournez-la-pizza-a-mi-hauteur-sur-une-grille 1*
en:black-carrot-juice-concentrate 1*
fr:sal 1*
E338 1
Nigari 1
fr:graines-de-pavot-bleu 1*
Smeltzout 1
de:pakirano-v-kontrolirani-atmosfer-warnung 1*
fr:45 1*
Reuzel 1
fr:for-questions-or-comments 1*
fr:weizengluten 1*
en:unbleached-wheat-flour 1*
Acerola 1
Zoete weipoeder 1
en:follc-acld 1*
en:wheat-flower 1*
Margarine 1
fr:stablisateur 1*
de:neto-količina 1*
Provençaalse kruiden 1
fr:de-gingembre-et-de-clou-de-girofle-extrait-naturel-de-noix-de-muscade 1*
es:infusion-de-te-de-jazmin 1*
Schaaldieren 1
Komijnzaad 1
fr:mononitrate 1*
Eiwitpoeder 1
fr:leinsaat 1*
Mango 1
fr:miel-destine-a-l-industrie 1*
de:napraforgo-ola 1*
fr:e202-acidifiant 1*
fr:annato 1*
Invertsuikerstroop 1
Knolselderij 1
fr:sin-colorantes-artificiales-sin-conservantes 1*
Vanillestokje 1
Bakkersgist 1
Clarified butter 1
Peulvruchten 1
Bosbes 1
Fresh onions 1
de:kleline-kinder-konnen-an-nüssen-ersticken 1*
Gepasteuriseerde koemelk 1
de:figyelem 1*
E508 1
de:kisgyermekelnel-a-hejas-gyümölcsok-fulladást-okozhatnak 1*
de:opozorile 1*
fr:liste-des-ingredients 1*
de:somagolásban 1*
fr:norwalk 1*
de:netto-tomeg 1*
de:siehe-dosenboden 1*
de:ungeofnet-mindestens-halthar-bis-ende 1*
en:coarse-sea-salt 1*
de:mindseget-megin-dontatiaul-a-jelzett-hinap-végéig 1*
Natuurlijk vanille-extract 1
de:honap 1*
de:évl-lásd-aljian-a-can 1*
fr:ing-ura-de-panaderia 1*
de:e-uporabno-najimanj-do-konca-glej-dno-pločevinke-nergestllt-in-der-eu 1*
de:proizvedeno-v-e-grf-gmbh 1*
fr:h 1*
es:concentrado-lactico-lechero 1*
Kiwi 1
fr:suiker 1*
Bourbon vanilla 1
Non-hydrogenated vegetable fats 1
fr:geplet-ble 1*
Gedroogde basilicum 1
fr:sarrasin-concasse 1*
fr:pendant-8-a-10-minutes 1*
fr:sesamzaad 1*
fr:Gorge de porc 1
Chorizo 1
fr:champignon-de-paris-antioxydant 1*
fr:conserveermiddel 1*
NE401 1
fr:beurre-sale-fleur-de-sel-et-sel-de-guerande 1*
Thiaminemononitraat 1
Calcium 1
Komkommer 1
en:tapioca-glucose 1*
Banaan 1
E282 1
Kippenvlees 1
E120 1
de:industriestraße-2 1*
fr:propioncat 1*
ru:патока 1*
E150 1
en:milk-fat 1*
fr:gluten-de-gist 1*
fr:extract-van-ace 1*
Bonenmeel 1
Meiraap 1
artisjokken-fair-trade-organic 1*
Acerola-extract 1
E211 1
fr:rola 1*
Dierlijk vet 1
fr:tarwebloem 1*
Mint flavouring 1
Druivensap 1
Limoensap 1
Citroenschil 1
fr:wasser 1*
fr:1-1oz 1*
fr:2-000-less-than-65g-less-than-20g-b0b 1*
fr:bevat-alco 1*
en:shitake-mushroom 1*
fr:saumon-sale 1*
fr:th-7 1*
de:hivds 1*
Acaciavezels 1
Paneermeel 1
fr:egg-pepperidge-farm 1*
fr:fumet-de-saumon-fume 1*
E953 1
fr:nutrition-serving-size-1-cookie 1*
fr:enriched-whea 1*
Knoflookpuree 1
Parijse champignons 1
Paddenstoel 1
Groentebouillon 1
E101 1
fr:beurre-emmental-oignon-vin-blanc 1*
fi:ja-carmolis-oljy 1*
Cardamon 1
ru:арахис-обжаренный 1*
Sjalot 1
fr:persil-arome 1*
fr:ceufs-et-cereales 1*
Gereconstitueerde boter 1
fr:sissant 1*
fr:creme-stabilisant 1*
es:de-los-cuales-queso-cheddar-semicurado-24-en-el-producto-terminado 1*
E472b 1
E464 1
fr:z-cuire-12-a-15-minutes 1*
fr:ste-delabli-div 1*
fr:raapolie 1*
Octopus 1
Pantotheenzuur 1
E452 1
Kippen 1
Augurken 1
Framboos 1
fr:sorbitol-sucre-inverti 1*
fr:enzymes-d-affinage-du-fromage 1*
fr:ct-06856-partially-produced-with-genetic-engineering-0-910008005969-6-9-0068-vitamin-a-2-0-baked-in-u-s-a 1*
E224 1
Thiamine 1
fr:gras-de-porc-issu-de-porcs-label-rouge 1*
Pastas 1
E392 1
Half ingedikte tomatenpuree 1
E162 1
E420 1
Groene paprika 1
Oliën en vetten 1
Blend of honeys 1
de:araidi 1*
fr:reine-claude-du-sud-ouest 1*
fr:Origan déshydraté 1
fr:Carré de porc 1
Arborio rice 1
Oregano 1
en:peach-puree-from-concentrate-min 1*
da:Fedtfattig kakao 1
de:osszetevok-földimogyoró 1*
Pluimvee 1
fr:cocoae-nonfat-milk 1*
Casing 1
Poultry meat 1
Saffloer 1
en:reduced-iron 1*
Asperge 1
Beetroot powder 1
fr:Boyau naturel de mouton 1
Sheeps casing 1
fr:dont-arome-asperge 1*
fr:jodiertes-speisesalz 1*
fr:hol 1*
fr:Foie de porc 1
Natuurlijk aroma van limoen 1
fr:sucre-eau 1*
Vet 1
fr:cocida-a-la-lena 1*
Gemalen geëxtraheerde vanillestokjes 1
Speltmeel 1
Foliumzuur 1
fr:rocou-carotenoides-caramel 1*
Vanilla seeds 1
Uitgeputte vanillestokjes 1
Folaat 1
Pijlinktvissen 1
Olijfolie extra vierge 1
fr:ingredients-cereales 1*
fr:sucre-miel-5-sel 1*
fr:ngredients 1*
fr:vitamines-bi-b2 1*
fr:bonenmeel 1*
Vitamine B6 1
Ongeraffineerd zeezout 1
fr:carbonate-de-calcium-arome-naturel-colorants 1*